PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 484486
Common NameARALYDRAFT_484486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 319aa    MW: 33736.3 Da    PI: 7.5055
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
484486genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.94.3e-3972155386
     TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
             +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tg+++++as+  +++ss+s+++++
  484486  72 PKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGSGTIPASALASAASSVSNHHQG 155
             6999****************************************************************9994444444444443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.1E-3276247IPR005333Transcription factor, TCP
PROSITE profilePS5136928.01677131IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDPKNLNRHQ VPNFLNPPPP RNQGLGDAAV VSDDKDENRK PTTEIKDFQI VVSASDKEPN  60
TKKTQNQNQL GPKRSSNKDR HTKVEGRGRR IRMPALCAAR IFQLTRELGH KSDGETIQWL  120
LQQAEPSIIA ATGSGTIPAS ALASAASSVS NHHQGGSLTT GLMISHDLDG GSSSGRPLNW  180
GIGGGEGVSR SNLPTGLWPN VAGFGSGVPT TGLMSEGAGY RIGFPGFDFP GVGPMSFASI  240
LGGAGGNHNQ MPGLELGLSQ EGNVGVLNPQ SFTQIYQQMG QAQAQAQAQG RVLHHMHHNH  300
EEHQQESGEK DDSQGSGR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00005PBM25215497Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266490.0AB026649.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MOJ10.
GenBankAJ2917490.0AJ291749.1 Arabidopsis thaliana mRNA for putative transcription factor (PCF1 gene).
GenBankAK1181780.0AK118178.1 Arabidopsis thaliana At3g27010 mRNA for unknown protein, complete cds, clone: RAFL19-49-P20.
GenBankBT0060430.0BT006043.1 Arabidopsis thaliana clone U50934 unknown protein (At3g27010) mRNA, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002877010.10.0hypothetical protein ARALYDRAFT_484486
SwissprotQ9LSD51e-176TCP20_ARATH; Transcription factor TCP20
TrEMBLD7LRC30.0D7LRC3_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.5__478__AT3G27010.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40502759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-160TCP family protein